Product Usage: This product is intended as a research chemical only. This designation permits the use of research chemicals strictly for in vitro testing and laboratory research, but not for human or animal.. This product should only be handled by licensed, qualified professionals. All information available on this website is for educational purposes only. This product is not a drug, food, or cosmetic and may not be misbranded, misused, or mislabeled as such. Acknowledged to the Terms and Conditions, the customer hereby agrees to take full responsibility on how to use the product.
Description
xCOG449 (OP449) Peptide – PP2A Activator & SET Inhibitor for Anti-Cancer Research
Product Name: COG449 (OP449)
Synonyms: OP449, SET Inhibitor, PP2A Activator
Sequence:
(Ac-RQIKIWFQNRRMKWKKCLRVRLASHLRKLRKRLL-NH2)-BMOE-(Ac-RQIKIWFQNRRMKWKKCLRVRLASHLRKLRKRLL-NH2)
Molecular Formula: C₄₀₄H₆₉₄N₁₄₂O₇₆S₄
Molecular Weight: 9223 g/mol
CAS Number: Not Available
Purity: >98%
Appearance: White to off-white powder
Application: For research use only
Storage: −20°C (long term), sealed and protected from light and moisture
Shipping: Ambient (domestic); varies for international orders
What is COG449 (OP449)?
COG449, also referred to as OP449, is a synthetic cell-penetrating peptide originally developed by Cognosci, Inc. and later advanced by Oncotide Pharmaceuticals. This research-grade peptide is a SET inhibitor that works by disrupting intracellular interactions critical for tumor survival and progression.
Mechanism of Action
COG449 targets and inhibits the SET oncoprotein, which is known to suppress the activity of protein phosphatase 2A (PP2A a well-established tumor suppressor. By blocking SET, COG449 peptide activates PP2A, potentially restoring its function in downregulating cancer-promoting pathways.
This peptide is being explored for its effects in anti-cancer research, especially in hematologic malignancies and drug-resistant solid tumors.
COG449 OP449 Peptide Benefits
● SET Inhibition: Restores tumor suppressor activity of PP2A
● PP2A Activation: Reactivates cellular control mechanisms over oncogenic signaling
● Enhances Drug Sensitivity: Potentially improves efficacy of tyrosine kinase inhibitors
● Preclinical Tumor Suppression: Shown to inhibit tumor cell proliferation in multiple cancer models
COG449 PP2A Activator Uses in Cancer Research
● Leukemia Studies: Shows promise in suppressing cell viability in AML and CML models
● Lymphoma Research: Investigated for effects in Burkitt’s lymphoma
● Oral Squamous Cell Carcinoma Models: Demonstrates ability to interfere with tumor progression
● Drug Resistance Investigations: Explored in combination therapies targeting tyrosine kinase resistance
Chemical Specifications
|
Property |
Details |
|
Peptide Sequence |
(RQIKIWFQNRRMKWKKCLRVRLASHLRKLRKRLL)₂ |
|
Molecular Formula |
C₄₀₄H₆₉₄N₁₄₂O₇₆S₄ |
|
Molecular Weight |
9223 g/mol |
|
Purity |
>98% |
|
Form |
Lyophilized Powder |
|
Color |
White to off-white |
Buy COG449 PP2A Activator Online
Looking to buy COG449 OP449 peptide online for your laboratory or institution? We supply high-purity COG449 peptide designed for advanced cancer and cell signaling research. Bulk quantities and custom packaging available for academic, biotech, or pharmaceutical research.
Important Note
COG449 is not intended for human or veterinary use. It is strictly for laboratory research purposes. The safety and efficacy in humans have not been established, and it has not received regulatory approval as a therapeutic agent.
Shipping & Return
xReturns Policy
At Qualitide, we are committed to ensuring your satisfaction with our products. Our Satisfaction Guarantee policy allows you to return or exchange any item within 14 days of receiving your order if you are not completely satisfied. Return/Exchange Eligibility To be eligible for a return or exchange: The item must be in its original condition as received, unworn or unused, with tags attached, and in its original packaging. You must provide the receipt or proof of purchase..
If you need to return an item, simply login to your account, view the order using the "Complete Orders" link under the My Account menu and click the Return Item(s) button. We'll notify you via e-mail of your refund once we've received and processed the returned item.
Shipping
At QUALITIDE, we aim to make your shopping experience simple and smooth. Here’s how we handle shipping: Processing Time We process all orders within 0 to 1 business day. Orders placed after business hours, on weekends, or on holidays will be processed the next business day. Delivery Time Once processed, delivery takes 2 to 3 business days, depending on your location and the shipping carrier. Total Delivery Time From placing your order to receiving it, the total time is 2 to 4 business days, including both processing and shipping.
Disclaimer
xAll articles and product information provided on this website are for informational and educational purposes only. The products offered on Qualitides are intended solely for in-vitro research purposes. In-vitro studies ("in glass" studies) are conducted outside of the body. These products are not medicines or drugs and have not been evaluated or approved by the FDA to prevent, treat, diagnose, or cure any medical condition, ailment, or disease. Any form of bodily introduction or administration of these products into humans or animals is strictly prohibited by law. By using this website, you acknowledge and agree to comply with all applicable regulations and restrictions related to the products provided by Qualitides.
Certificates
x- Choosing a selection results in a full page refresh.