Sidebar

Categories

Availability

Price

$
to
$

Category

Product type

Cosmetic Peptides

Acetyl Dipeptide-1 Cetyl Ester vial promoting skin elasticity and firmness.Acetyl Dipeptide-1 Cetyl Ester (Idealift™)
Acetyl Dipeptide-1 Cetyl Ester
Enhance Your Skin with Idealift™ Acetyl Dipeptide-1 Cetyl Ester, also referred to as Lipo-dipeptide Tyr-Arg or N-Acetyl-Tyrosyl-Arginyl-Hexadecyl Ester (NATAH), is a cutting-edge lipopeptide developed by Sederma. It is widely recognized in skincare under the trade name Idealift™ for its potential benefits. Key Benefit: Supports Skin Elasticity...
from $107.00 USD
from $107.00 USD
Choose options
Choose options
Vial of Glutathione (GSH) for research use, 99% purity, 1g quantity.Antioxidant Peptide Glutathione (GSH)
Antioxidant Peptide Glutathione (GSH)
L-Glutathione Peptide – Antioxidant for Anti-Aging, Skin Brightening & Brain Health Product Name: L-Glutathione (GSH) Synonyms: GSH, Reduced Glutathione, Glutathione Peptide CAS Number: 70-18-8 FDA UNII: GAN16C9B8O Molecular Formula: C₁₀H₁₇N₃O₆S Molecular Weight: 307.32 g/mol Purity: >98% Form: Lyophilized Powder Appearance: White to off-white solid Storage: −20°C (long-term), protect from light and moisture Shipping: Ships...
from $62.40 USD
$141.67 USD
from $62.40 USD
Choose options
Choose options
Acetyl Hexapeptide-8 Argireline vial for wrinkle reduction and smoother skin.Acetyl Hexapeptide-8 (Argireline®)
Acetyl Hexapeptide-8 (Argireline®)
Acetyl Hexapeptide-8 (Argireline®) | Advanced Anti-Aging Peptide for Wrinkles & Fine Lines Product Overview: Acetyl Hexapeptide-8, commonly known as Argireline®, is a powerful topical peptide developed to reduce the appearance of fine lines and expression wrinkles. Often referred to as the “Botox in a...
from $97.00 USD
from $97.00 USD
Choose options
Choose options
Research Peptides

Research Peptides

Research peptides are used to study the biochemistry, genetics, physiology, and pharmacology of peptides. The peptides listed here can only be used in laboratories and research studies, not intended for human or animal consumption, diagnosis, or treatment. Qualitde team has more than twenty years of experience in peptide research in a variety of research fields. Now we are dedicated to providing the high-quality peptides to meet your scientific research needs.

Filter
  • 10
  • 15
  • 20
  • 25
  • 30
  • 50
  • Featured
  • Best selling
  • Alphabetically, A-Z
  • Alphabetically, Z-A
  • Price, low to high
  • Price, high to low
  • Date, old to new
  • Date, new to old
Sort

Sort by:

  • Featured
  • Best selling
  • Alphabetically, A-Z
  • Alphabetically, Z-A
  • Price, low to high
  • Price, high to low
  • Date, old to new
  • Date, new to old
  • COG449 (OP449)COG449 (OP449)
    COG449 (OP449), PP2A activator and SET inhibitor
    COG449 (OP449) Peptide – PP2A Activator & SET Inhibitor for Anti-Cancer Research Product Name: COG449 (OP449) Synonyms: OP449, SET Inhibitor, PP2A Activator Sequence: (RQIKIWFQNRRMKWKKCLRVRLASHLRKLRKRLL)₂ Molecular Formula: C₄₀₄H₆₉₄N₁₄₂O₇₆S₄ Molecular Weight: 9223 g/mol CAS Number: Not Available Purity: >98% Appearance: White to off-white powder Application: For research use only Storage: −20°C (long term), sealed and...
    from $289.00 USD
    from $289.00 USD
    Choose options
    Choose options
  • COG112 ApoE mimetic peptide bottle for research use, brown glass with black cap.COG112, ApoE Mimetic Peptide
    COG112, ApoE Mimetic Peptide
    COG112 ApoE Mimetic Peptide | Anti-Inflammatory & Neuroprotective Research Peptide Product Overview: COG112 is a synthetic Apolipoprotein E (ApoE) mimetic peptide designed by conjugating the receptor-binding domain of ApoE (COG133) with the cell-penetrating peptide (CPP) antennapedia (Antp). This modification significantly enhances the peptide’s anti-inflammatory...
    from $166.32 USD
    $189.00 USD
    from $166.32 USD
    Choose options
    Choose options
  • ApoE Mimetic Peptide COG1410 in amber bottleApoE Mimetic Peptide COG1410
    COG1410, ApoE Mimetic Peptide
    COG1410 ApoE Mimetic Peptide | Neuroprotective & Anti-Inflammatory Research Peptide Product Name: COG1410 Synonym: ApoE Mimetic Peptide CAS Number: 878009-24-6 Molecular Formula: C₆₄H₁₂₁N₂₁O₁₄ Molecular Weight: 1408.78 g/mol Sequence: Ac-AS-{Aib}-LRKL-{Aib}-KRLL-NH₂ Purity: ≥98% Appearance: Solid, white to off-white What is COG1410? COG1410 ApoE mimetic peptide is a synthetic peptide derived from the receptor-binding...
    from $115.20 USD
    $240.00 USD
    from $115.20 USD
    Choose options
    Choose options
  • Oxytocin, The Love HormoneOxytocin vial labeled for research, 99% purity.
    Oxytocin, The Love Hormone
    Oxytocin Peptide – The Love Hormone for Mood, Stress & Emotional Wellness What Is Oxytocin? Oxytocin is a natural peptide hormone and neuropeptide, often called the “love hormone”, known for its essential role in emotional bonding, social behavior, stress relief, and reproductive health. Synthesized...
    from $59.00 USD
    from $59.00 USD
    Choose options
    Choose options
  • Oxytocin Nasal Spray (1 oz, 20 IU/spray)Oxytocin Nasal Spray (1 oz, 20 IU/spray)
    OxyGen® Oxytocin Nasal Spray (20 IU per spray)
    Oxytocin is a cyclic neuropeptide hormone produced in the hypothalamus and secreted by the posterior pituitary gland. It plays a crucial role in various physiological processes, including sexual reproduction, childbirth, wound healing and social bonding, and lactation. Oxytocin is also involved in the management of stress, anxiety,...
    from $37.00 USD
    $44.99 USD
    from $37.00 USD
    Choose options
    Choose options
  • OxyGen® Oxytocin Body Spray (20 IU/spray)Oxytocin Body Spray (20 IU/spray, 10mL)
    OxyGen® Oxytocin Body Spray (20 IU/spray)
    OxyGen® Oxytocin Body Spray – For Mood, Stress Relief & Social Bonding Product Overview: OxyGen® is a premium Oxytocin body spray for mood and relaxation, designed to help you feel more connected, calm, and socially confident. This oxytocin body spray for social bonding enhances...
    from $38.00 USD
    $47.00 USD
    from $38.00 USD
    Choose options
    Choose options
  • NAD+ (Nicotinamide Adenine Dinucleotide)
    NAD+ (Nicotinamide Adenine Dinucleotide)
    Nicotinamide Adenine Dinucleotide (NAD+) is a coenzyme that is present in each living cell in the body. It is produced from the breakdown of nicotinamide riboside (niagen), an alternative form of vitamin B3 (niacin). NAD+ plays an integral role in energy production and regulation...
    $69.00 USD
    $79.99 USD
    $69.00 USD
  • Selank (Tuftsin Peptide) Powder-10mg
    Selank (Tuftsin Peptide)
    Selank Peptide Selank is a synthetic analog of the peptide tuftsin, an endogenous peptide that regulates the immune system [1]. Informally, it falls under the category of nootropic agents, which are substances known for their ability to improve learning, memory, and other cognitive processes....
    $49.00 USD
    $49.00 USD
  • Cerebrolysin Powder Cerebrolysin Powder
    Cerebrolysin, nootropic for brain function, protection and recovery
    Cerebrolysin is a nootropic drug, which means that it has the capacity to enhance a number of cognitive functions such as memory, concentration, and thinking skills. It is used in the treatment of memory disorders, concentration disorders, and degenerative dementia, including Alzheimer’s disease. Cerebrolysin...
    from $119.00 USD
    from $119.00 USD
    Choose options
    Choose options
  • Semax Peptide vial, 25 mg, 99% purity by HPLC, for research use.
    Semax Peptide
    Semax is a synthetic peptide developed based on the molecular structure of the adrenocorticotropic hormone, which is produced by the pituitary gland. It was originally used in Russia for the prevention and treatment of circulatory disorders such as stroke. It has the ability to...
    $58.00 USD
    $58.00 USD
  • N-Acetyl Semax: 25mg vial for research use, high purity peptide.
    N-Acetyl-Semax
    N-Acetyl Semax is a synthetic polypeptide analogous to the naturally occurring adrenocorticotropic hormone (ACTH). The peptide is similar to a fragment from the adrenocorticotropic hormone ACTH (4-7), specifically Met-Glu-His-Phe, combined with a Pro-Gly-Pro extension at the C-terminus.(1) The addition of Pro-Gly-Pro (PGP) to N-Acetyl...
    $59.00 USD
    $59.00 USD
  • NMN (β-Nicotinamide Mononucleotide)
    NMN (β-Nicotinamide Mononucleotide)
    NMN (β-Nicotinamide mononucleotide) is a natural molecule produced by the body and is classified as a nucleotide. Nucleotides are involved in a wide array of important bodily functions, including as the building blocks of DNA. Within the cells, NMN is converted into another molecule...
    $68.00 USD
    $68.00 USD
  • BPC-157 Peptide (10mg)
    BPC-157 Peptide (10mg)
    BPC-157 Peptide The BPC-157 peptide, also known as Pentadecapeptide BPC 157 or Body Protection Compound 157, is a synthetic compound that has been suggested in various studies to assist with healing joint, tendon, and muscle tissue, as well as nerve tissue. BPC-157 is a...
    $93.00 USD
    $93.00 USD

Recently Viewed Products